Media & Matrices Exosomes Matrigen Softwell Growth Factors Small Molecules Gene Knock-Up Karyotype Service

Recombinant Human IL-27 / EBI-3 Protein

   
Interleukin 27 / EBI-3   Epstein-Barr Virus Induced Gene-3 (EBI-3), is a secreted glycoprotein belonging to the hematopoietin receptor family and related to the p40 subunit of  IL-12. It was identified by its induced expression in B-lymphocytes in response to Epstein-Barr virus infection. EBI-3 forms heterodimers with p28 to form IL-27 and with p35 to form IL-35. Both IL-27 and IL-35 have anti-inflammatory and regulatory activity.  Recombinant Human EBI is a non-glycosylated  polypeptide chain.    Assay data for Human recombinant EBI-3 is based upon qualitative binding to anti-EBI-3 antibody.
         
209 αα 23.3 kDa Q14213 >90% E. coli -20oC


Physical Appearance

Sterile Filtered white lyophilized (freeze-dried) powder.

Formulation

Lyopohilized with no additives.

Reconstitution

Centrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 – 0.5 mg/ml, which can be further diluted into other aqueous solutions.

Stability

Lyophilized product is very stable at -20°C. Reconstituted material should be aliquoted and frozen at -20°C. It is recommended to add a carrier protein (0.1% HSA or BSA) for long term storage.

Protein Content determined by

UV spectroscopy at 280 nm. Quantitation on SDS-PAGE against a known standard.

Endotoxin

Endotoxin level as measured by LAL is <0.01ng/ug or <0.1EU/ug.

Alternative Names

Epstein-Barr virus induced 3, IL-27 subunit beta, Epstein-Barr virus-induced gene 3 protein, interleukin-27 subunit beta, EBV-induced gene 3 protein, Epstein-Barr virus induced gene 3, IL-27B, cytokine receptor, IL27B     

AA Sequence

RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK 

FOR RESEARCH USE ONLY