Recombinant Human IL-27 / EBI-3 protein

Growth factors from Cell Guidance Systems are high purity suitable for the most demanding applications where biological activity is required.

Alisases

Epstein-Barr virus induced 3, IL-27 subunit beta, Epstein-Barr virus-induced gene 3 protein, interleukin-27 subunit beta, EBV-induced gene 3 protein, Epstein-Barr virus induced gene 3, IL-27B, cytokine receptor, IL27B     

Description:

Epstein-Barr Virus Induced Gene-3 (EBI-3), is a secreted glycoprotein belonging to the hematopoietin receptor family and related to the p40 subunit of  IL-12.  It was identified by its induced expression in B-lymphocytes in response to Epstein-Barr virus infection.  EBI-3 forms heterodimers with p28 to form IL-27 and with p35 to form IL-35.  Both IL-27 and IL-35 have anti-inflammatory and regulatory activity.  Recombinant Human EBI is a non-glycosylated  polypeptide chain consisting of  209 amino acids with a molecular weight of  23.3 kDa.

Additional ImageAdditional Image

Physical Appearance:

Sterile Filtered white lyophilized (freeze-dried) powder.

Source:

E.coli

Formulation:

Lyopohilized with no additives.

Reconstitution:

Centrifuge vial before opening. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 – 0.5 mg/ml, which can be further diluted into other aqueous solutions.

Stability:

Lyophilized product is very stable at -20°C. Reconstituted material should be aliquoted and frozen at -20°C. It is recommended to add a carrier protein (0.1% HSA or BSA) for long term storage.

Purity Greater than 90% as determined by:

Reducing and non-reducing SDS-PAGE.

Analytical HPLC.

Protein Content determined by:

UV spectroscopy at 280 nm.

Quantitation on SDS-PAGE against a known standard.

Biological Activity:

Assay data for Human recombinant EBI-3 is based upon qualitative binding to anti-EBI-3 antibody.

Endotoxin:

Endotoxin level as measured by LAL is <0.01ng/ug or <0.1EU/ug.

AA Sequence:

RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK 

FOR RESEARCH USE ONLY.