PODS® Human BMP-3

Code Description Price Qty
PPH54-25 PODS® Human BMP-3 $175.00
PPH54-250 PODS® Human BMP-3 $850.00
PPH54-1000 PODS® Human BMP-3 $2,800.00
PODS® co-crystals
PODS® co-crystals

PODS® Technology

PODS® proteins are made using an insect cell expression system in which the active protein is co-expressed alongside polyhedrin carrier protein. Polyhedrin forms microcrystals within insect cells which specifically capture the active protein to form a co-crystal complex. The active protein is captured in its nascent, natively folded form with limited scope for proteolytic degradation. Consequently, excellent levels of bioactivity are observed. The PODS® co-crystals provide a sustained release mechanism and can be used to functionalize surfaces. For further details, please refer to the PODS® Technology page.

Product Description

The product contains the polyhedrin protein co-crystalized with Human BMP-3. BMP-3, also known as Bone Morphogenetic Protein 3 or osteogenin, is a member of the TGF superfamily of proteins. Akin to the other functionally and structurally related bone morphogenic proteins (BMPs), BMP-3 is involved in cartilage and bone formation. However, unlike most other BMPs, BMP-3 negatively regulates bone density by antagonizing the ability of osteogenic BMPs, such as BMP-2, to induce osteoprogenitor differentiation and ossification. It has been suggested that this inhibitory effect could be through an Activin signalling pathway rather than direct competition with osteogenic BMPs. The BMP-3 protein is a disulfide-linked homodimer and highly conserved across animal species; for example, the amino acid sequence of human and rat BMP-3 are 98% identical. BMP-3 is frequently expressed in adult and foetal cartilage.

Usage Recommendation

PODS® are pure protein co-crystals consisting of polyhedrin, a structural scaffold protein, and a cargo protein. Under the action of proteases, which degrade the scaffold protein, PODS provide sustained release of the cargo protein. Any cargo growth factor molecule contained within PODS is not available to cells and not bioactive. Once released, growth factors become available to bind cells and are bioactive. The concentration to which a growth factor accumulates in cell culture media (or in-vivo environment) will depend on the amount of cargo (contained in PODS) added, the rate of cargo release, and the subsequent rate of degradation of the released cargo protein. As a rule of thumb, in the presence of 10% serum, peak levels of available growth factors released from PODS are reached within 24-48 hours. Typically, at this point 20% of the growth factor cargo initially contained within the PODS is present in a soluble form and available to bind cells. For example, if PODS containing 100 ng of cargo are added to 10 ml of cell culture media containing 10% serum, it can be expected that 20 ng will be released after 24 hours to give a concentration of available growth factor of 2 ng/ml. The concentration that you need for a particular application will likely be lower than the equivalent conventional growth factor.  This is because PODS are better at maintaining minimum growth factor concentrations. Pre-incubating PODS with serum for 24 hours prior to culture will ensure that available growth factor is immediately present. Ultimately, the amount of PODS growth factor that is optimal for a particular experiment should be optimized empirically.  

Animal-Free

This product is produced with no animal derived raw products. All processing and handling employs animal free equipment and animal free protocols.

AA Sequence

MADVAGTSNRDFRGREQRLFNSEQYNYNNSKNSRPSTSLYKKAGFQWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR*

Alternative Names

BMP3, BMP3A, BMP-3A, Bone Morphogenetic Protein 3, Bone Morphogenetic Protein 3A, Osteogenin

Research Use Only

This product is for Research Use Only.

PODS universal cargo antibody and ELISA

Use the PODS universal cargo antibody (PUCA) for western blots and other assays to monitor the release of cargo proteins released from PODS. This works with all PODS proteins with few exceptions. In addition, an optimized PUCA ELISA is available

Product Details
Length

111 aa

Molecular Weight

35.2 kDa

Structure

Dimer

Source

Spodoptera frugiperda (Sf9) cell culture

Accession Number

P12645

Endotoxin Level

<0.06 EU/ml as measured by gel clot LAL assay

Formulation

PODS® were lyophilized from a volatile solution

Reconstitution

Ensure the PODS® are resuspended in buffer by pipetting up and down immediately before aliquoting. PODS® may be reconstituted at 100 ug/ml in water. 20% glucose has a buoyant density closer to PODS® and can be useful for slowing sedimentation when aliquoting. PODS® are highly stable when stored in aqueous solution (pH range 6 - 8). 

Stability and Storage

Upon receipt, store at 4®C. PODS® co-crystals are stable for at least 1 year when dry and 6 months when resuspended.

References

Fasséli Coulibaly, Elaine Chiu, Keiko Ikeda, Sascha Gutmann, Peter W. Haebel, Clemens Schulze-Briese, Hajime Mori, and Peter Metcalf. The molecular organization of cypovirus polyhedra. (2007) Nature. 446: 97-101.

 

Rey FA. Virology: Holed up in a natural crystal. (2007) Nature. 446: 35-37.

 

Mori H. Immobilization of Bioactive Growth Factors into Cubic Proteinous Microcrystals (Cypovirus Polyhedra) and Control of Cell Proliferation and Differentiation. (2010) NSTI-Nanotech. 3: 222-225.

 

Satoshi Abe, Hiroshi Ijiri, Hashiru Negishi, Hiroyuki Yamanaka, Katsuhito Sasaki, Kunio Hirata, Hajime Mori, and Takafumi Ueno. Design of Enzyme-Encapsulated Protein Containers by In-Vivo Crystal Engineering. (2015) Advanced Materials. 27(48): 7951-7956.